Catalogue number
CHM-261
Synonyms
IL-8, CXCL8, Monocyte-derived neutrophil chemotactic factor, MDNCF, T-cell chemotactic factor, Neutrophil-activating protein 1, NAP-1, Protein 3-10C, Granulocyte chemotactic protein 1, GCP-1, Monocyte-derived neutrophil-activating peptide, MONAP, Emoctakin, K60, NAF, LECT, LUCT, 3-10C, LYNAP, SCYB8, TSG-1, AMCF-I, b-ENAP.
Introduction
Interleukin-8 (IL-8) is a chemokine produced by macrophages and other cell types such as epithelial cells. It is also synthesized by endothelial cells, which store IL-8 in their storage vesicles, the Weibel-Palade bodies. When first encountering an antigen, the primary cells to encounter it are the macrophages who phagocytose the particle. Upon processing, they release chemokines to signal other immune cells to come in to the site of inflammation. IL-8 is one such chemokine. It serves as a chemical signal that attracts neutrophils at the site of inflammation, and therefore is also known as Neutrophil Chemotactic Factor.
Description
IL-8 Rabbit Recombinant is a full length secreted protein (79 amino acids - a.a. 23-101). The IL-8 is expressed in E.Coli. and fused to a N-terminal His tag, having a total MW of 12.24kDa.
Source
Escherichia Coli.
Physical Appearance
Sterile Filtered colorless solution.
Formulation
The IL-8 solution (1mg/ml) contains 50mM Tris, 300mM NaCl, 10% Glycerol, pH 7.5.
Stability
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Purity
Greater than 90% as determined by SDS-PAGE.
Amino acid sequence
AVLTRIGTELRCQCIKTHSTPFHPKFIKELRVIESGPHCANSEIIVKLVDGRELCLDPKEKWVQKVV QIFLKRAEQQES.
Safety Data Sheet
Usage
Prospec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.